Rac-like GTP-binding protein ARAC11 197 MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAAIRVVLQPPKQKKKKSKAQKACSIL ROP1 Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation (By similarity). At3g51300 GTPase protein ROP1 RAC11_ARATH F24M12.340 May be involved in cell polarity control during the actin-dependent tip growth of pollen tubes. May regulate callose synthase 1 (CALS1) activity through the interaction with UGT1. ARAC11